Home Page
cover of Instantaneous Transportation
Instantaneous Transportation

Instantaneous Transportation

sonicfableforgesonicfableforge

0 followers

00:00-00:01

The audio titled "Instantaneous Transportation" starts with a captivating, futuristic sound. You can sense the science and power elements through a pulsating, electric hum that intensifies, mimicking the buildup of a teleportation device. The sound of laser beams firing forms a consistent rhythm, hinting at the high-tech, digital aspects of the audio. Midway through, there's a sudden pause followed by a dramatic sonic boom, perfectly encapsulating the instant transition of teleportation. The audio then transitions into a serene, celestial melody symbolizing the tranquil vastness of space. This soothing sequence is occasionally interrupted by sharp, electric sound effects, signifying the continuous use of electricity and its immense power in this futuristic setting. As the audio progresses, you can hear digital blips and beeps, reminiscent of a video game. This gives a nod to the game tag, suggesting the concept of teleportation isn't merely confined to reality, but is also a signific

Sound Effectsteleportlaserelectricpowerspaceelectricitysciencegamefuturedigital

Audio hosting, extended storage and much more

MORE INFO

Listen to Instantaneous Transportation by sonicfableforge MP3 song. Instantaneous Transportation song from sonicfableforge is available on Audio.com. The duration of song is 00:01. This high-quality MP3 track has 160 kbps bitrate and was uploaded on 27 Apr 2024. Stream and download Instantaneous Transportation by sonicfableforge for free on Audio.com – your ultimate destination for MP3 music.

TitleInstantaneous Transportation
Authorsonicfableforge
CategorySound Effects
Duration00:01
FormatAUDIO/MPEG
Bitrate160 kbps
Size37.44KB
Uploaded27 Apr 2024

Featured in

Listen Next

Other Creators

Comment

500 symbols max

Loading comments...